Journal: Journal of Innate Immunity

Article Title: A Common Genetic Variation in Langerin (CD207) Compromises Cellular Uptake of Staphylococcus aureus

doi: 10.1159/000500547

Figure Lengend Snippet: Strains used in this study [ 12 , 32 , 33 , 34 , 35 ]

Article Snippet: S. pyogenes MGAS315 [ 12 ] (Table ) was grown overnight at 37°C without agitation in 5 mL THB (Becton Dickinson) supplemented with 1% yeast extract (Oxoid). table ft1 table-wrap mode="anchored" t5 Table 1 caption a7 Strain Source S. aureus USA300 (NRS384, CC8) NARSA strain collection S. aureus USA300 Δ tarM (WTA α-GlcNAc deficient) [ 32 ] S. aureus Newman (CC8) ATCC, cat. No. 13420 S. aureus Newman Δ spa Δ sbi pCM29 (sGFP expressing) [ 12 ] S. aureus 82086 (CC398) [ 32 ] S. aureus PS66 (CC30) Udo Bläsi, Vienna S. aureus MW2 (CC1) [ 33 ] S. aureus Wood46 (CC97) ATCC, cat. No. 10832 S. aureus Mu50 (CC5) [ 33 ] S. aureus P68 (CC25) Udo Bläsi, Vienna S. aureus NRS184 (CC22) NARSA strain collection S. aureus JH1 (CC5) [ 34 ] S. pyogenes MGAS315 [ 35 ] Open in a separate window Strains used in this study [ 12 , 32 , 33 , 34 , 35 ] Production of Recombinant Langerin Extracellular Domains The extracellular domains of truncated human langerin (residues 148–328) and SNP variants thereof were recombinantly expressed from codon-optimized constructs containing a C-terminal TEV cleavage site followed by a Strep-tag II cloned into pUC19 expression vectors, expressed in E. coli BL21 (DE3; Thermo Fisher), purified and labeled as described previously [ 3 ].

Techniques: Expressing

Journal: Frontiers in Microbiology

Article Title: The combination of diethyldithiocarbamate and copper ions is active against Staphylococcus aureus and Staphylococcus epidermidis biofilms in vitro and in vivo

doi: 10.3389/fmicb.2022.999893

Figure Lengend Snippet: Minimal inhibitory concentration of the antibiotics methicillin (Meth), ceftazidime (Ceft), ciprofloxacin (Cip), vancomycin (Van), doxycycline (Doxy), amikacin (Amik), erythromycin (Erythro) and the compounds diethyldithiocarbamate (DDC) and Cu 2+ towards planktonic S. aureus , MRSA, S. epidermidis , E. coli and P. aeruginosa.

Article Snippet: Bioflux plates were primed with 350 μl half-strength tryptone soy broth (TSB, BD, Sparks, MD, United States) and inoculated with 70 μl of a bacterial overnight culture (either MRSA Mu50 or S. epidermidis ATCC 35984) adjusted to OD 600 of 0.2.

Techniques: Concentration Assay

Journal: Frontiers in Microbiology

Article Title: The combination of diethyldithiocarbamate and copper ions is active against Staphylococcus aureus and Staphylococcus epidermidis biofilms in vitro and in vivo

doi: 10.3389/fmicb.2022.999893

Figure Lengend Snippet: Effect of diethyldithiocarbamate (DDC) and Cu 2+ concentrations (in μg/ml) on the viability of (A) MRSA Mu50, (B) MRSA 2, (C) Staphylococcus epidermidis ATCC 35984 and (D) S. epidermidis ATCC 14990 biofilms compared to monotherapy with Cu 2+ ( n = 3; * p < 0.05; ** p < 0.01; *** p < 0.001).

Article Snippet: Bioflux plates were primed with 350 μl half-strength tryptone soy broth (TSB, BD, Sparks, MD, United States) and inoculated with 70 μl of a bacterial overnight culture (either MRSA Mu50 or S. epidermidis ATCC 35984) adjusted to OD 600 of 0.2.

Techniques:

Journal: Frontiers in Microbiology

Article Title: The combination of diethyldithiocarbamate and copper ions is active against Staphylococcus aureus and Staphylococcus epidermidis biofilms in vitro and in vivo

doi: 10.3389/fmicb.2022.999893

Figure Lengend Snippet: Synergistic effects of diethyldithiocarbamate in combination with Cu 2+ against S. aureus, MRSA and S. epidermidis biofilms.

Article Snippet: Bioflux plates were primed with 350 μl half-strength tryptone soy broth (TSB, BD, Sparks, MD, United States) and inoculated with 70 μl of a bacterial overnight culture (either MRSA Mu50 or S. epidermidis ATCC 35984) adjusted to OD 600 of 0.2.

Techniques:

Journal: Frontiers in Microbiology

Article Title: The combination of diethyldithiocarbamate and copper ions is active against Staphylococcus aureus and Staphylococcus epidermidis biofilms in vitro and in vivo

doi: 10.3389/fmicb.2022.999893

Figure Lengend Snippet: Minimal concentration to kill over 80% biofilm and synergistic effects of antibiotics, diethyldithiocarbamate and Cu 2+ (DDC-Cu 2+ ) and the combination against MRSA Mu50 ( n = 3).

Article Snippet: Bioflux plates were primed with 350 μl half-strength tryptone soy broth (TSB, BD, Sparks, MD, United States) and inoculated with 70 μl of a bacterial overnight culture (either MRSA Mu50 or S. epidermidis ATCC 35984) adjusted to OD 600 of 0.2.

Techniques: Concentration Assay

Journal: Frontiers in Microbiology

Article Title: The combination of diethyldithiocarbamate and copper ions is active against Staphylococcus aureus and Staphylococcus epidermidis biofilms in vitro and in vivo

doi: 10.3389/fmicb.2022.999893

Figure Lengend Snippet: Comparison of stained MRSA Mu50 and S. epidermidis ATCC 35984 biofilms with LIVE/DEAD BacLight staining after treatment with 8 μg/ml diethyldithiocarbamate and 32 μg/ml Cu 2+ (DDC-Cu 2+ ). Confocal microscopy images results: green = viable bacteria; red = dead bacteria. (A) Untreated S. epidermidis ATCC 35984 biofilm at 20×. S. epidermidis ATCC 35984 biofilm after treatment with DDC-Cu 2+ at (B) 20× and (D) 100×. (C) Quantification of images as green/red ratio of untreated control (black) and treatment with DDC-Cu 2+ (grey) of MRSA and S. epidermidis ATCC 35984 biofilms ( n = 3–8; *** p < 0.001).

Article Snippet: Bioflux plates were primed with 350 μl half-strength tryptone soy broth (TSB, BD, Sparks, MD, United States) and inoculated with 70 μl of a bacterial overnight culture (either MRSA Mu50 or S. epidermidis ATCC 35984) adjusted to OD 600 of 0.2.

Techniques: Staining, Confocal Microscopy

Journal: Frontiers in Microbiology

Article Title: The combination of diethyldithiocarbamate and copper ions is active against Staphylococcus aureus and Staphylococcus epidermidis biofilms in vitro and in vivo

doi: 10.3389/fmicb.2022.999893

Figure Lengend Snippet: Effect of 8 μg/ml diethyldithiocarbamate (DDC; orange), 32 μg/ml Cu 2+ (blue) and combined DDC-Cu 2+ (grey) on (A) the cell index of MRSA Mu50 and (C) S. epidermidis ATCC 35984 over 48 h compared to the untreated control (black). Comparison of the mean cell index between 12 and 48 h for each treatment of (B) MRSA Mu50 and (D) S. epidermidis ATCC 35984 ( n > 3; *** p < 0.001).

Article Snippet: Bioflux plates were primed with 350 μl half-strength tryptone soy broth (TSB, BD, Sparks, MD, United States) and inoculated with 70 μl of a bacterial overnight culture (either MRSA Mu50 or S. epidermidis ATCC 35984) adjusted to OD 600 of 0.2.

Techniques:

Journal: Frontiers in Microbiology

Article Title: The combination of diethyldithiocarbamate and copper ions is active against Staphylococcus aureus and Staphylococcus epidermidis biofilms in vitro and in vivo

doi: 10.3389/fmicb.2022.999893

Figure Lengend Snippet: Monitoring of MRSA Mu50 biofilm formation over 24 h when left untreated or treated with a combination of 8 μg/ml diethyldithiocarbamate and 32 μg/ml Cu 2+ combination (DDC-Cu 2+ ) using the Bioflux system. Scale bar represents 50 μm.

Article Snippet: Bioflux plates were primed with 350 μl half-strength tryptone soy broth (TSB, BD, Sparks, MD, United States) and inoculated with 70 μl of a bacterial overnight culture (either MRSA Mu50 or S. epidermidis ATCC 35984) adjusted to OD 600 of 0.2.

Techniques:

Journal: Frontiers in Microbiology

Article Title: The combination of diethyldithiocarbamate and copper ions is active against Staphylococcus aureus and Staphylococcus epidermidis biofilms in vitro and in vivo

doi: 10.3389/fmicb.2022.999893

Figure Lengend Snippet: Effect of diethyldithiocarbamate [DDC; orange; 8 μg/ml (A) , 6.4 mg/kg (B–D) ], Cu 2+ [blue; 32 μg/ml (A) , 25.6 mg/kg (B–D) ] and DDC-Cu 2+ (grey) on (A) fibroblast viability ( n = 3), on (B) probability of Galleria mellonella survival (30/group; n = 120), on the probability of survival of Galleria mellonella infected with (C) MRSA Mu50 (30/group; n = 120), and (D) infected with S. epidermidis ATCC 35984 (30/group; n = 120; NS = not significant; * p < 0.05; *** p < 0.001).

Article Snippet: Bioflux plates were primed with 350 μl half-strength tryptone soy broth (TSB, BD, Sparks, MD, United States) and inoculated with 70 μl of a bacterial overnight culture (either MRSA Mu50 or S. epidermidis ATCC 35984) adjusted to OD 600 of 0.2.

Techniques: Infection

Journal: Molecules

Article Title: New Biscoumarin Derivatives: Synthesis, Crystal Structure, Theoretical Study and Antibacterial Activity against Staphylococcus aureus

doi: 10.3390/molecules191219868

Figure Lengend Snippet: MIC of compounds 1 – 5 and antibiotics in Mueller-Hinton Broth Culture.

Article Snippet: Four S. aureus bacterial strains, including one drug-sensitive S. aureus ( S. aureus ATCC 29213) strain and three MRSA strains (MRSA XJ 75302, Mu50, USA 300 LAC), were used in the systematic analysis of the antibacterial activities of compounds 1 – 5 in vitro .

Techniques:

Journal: Molecules

Article Title: New Biscoumarin Derivatives: Synthesis, Crystal Structure, Theoretical Study and Antibacterial Activity against Staphylococcus aureus

doi: 10.3390/molecules191219868

Figure Lengend Snippet: Concentration-dependent inhibition of compound 1 on the growth of S. aureus ATCC 29213, MRSA XJ 75302, Mu50, and MRSA USA 300 LAC. The cells were cultured in liquid culture medium and treated with different concentrations of compound 1 .

Article Snippet: Four S. aureus bacterial strains, including one drug-sensitive S. aureus ( S. aureus ATCC 29213) strain and three MRSA strains (MRSA XJ 75302, Mu50, USA 300 LAC), were used in the systematic analysis of the antibacterial activities of compounds 1 – 5 in vitro .

Techniques: Concentration Assay, Inhibition, Cell Culture

Journal: Acta Crystallographica. Section F, Structural Biology Communications

Article Title: Neutron crystallographic study of heterotrimeric glutamine amidotransferase CAB

doi: 10.1107/S2053230X19000220

Figure Lengend Snippet: Macromolecule-production information (Nakamura et al. , 2006 ▸ , 2010 ▸ )

Article Snippet: Macromolecule-production information is given in Table 1 . table ft1 table-wrap mode="anchored" t5 Table 1 caption a7 Source organism S. aureus Mu50 Cloning site NcoI/XhoI Expression vector pET-28b(+) vector (Novagen) Expression host E. coli B834 strain Complete amino-acid sequence of the construct produced GatA MSIRYESVENLLTLIKDKKIKPSDVVKDIYDAIEETDPTIKSFLALDKENAIKKAQELDELQAKDQMDGKLFGIPMGIKDNIITNGLETTCASKMLEGFVPIYESTVMEKLHKENAVLIGKLNMDEFAMGGSTETSYFKKTVNPFDHKAVPGGSSGGSAAAVAAGLVPLSLGSDTGGSIRQPAAYCGVVGMKPTYGRVSRFGLVAFASSLDQIGPLTRNVKDNAIVLEAISGADVNDSTSAPVDDVDFTSEIGKDIKGLKVALPKEYLGEGVADDVKEAVQNAVETLKSLGAVVEEVSLPNTKFGIPSYYVIASSEASSNLSRFDGIRYGYHSKEAHSLEELYKMSRSEGFGKEVKRRIFLGTFALSSGYYDAYYKKSQKVRTLIKNDFDKVFENYDVVVGPTAPTTAFNLGEEIDDPLTMYANDLLTTPVNLAGLPGISVPCGQSNGRPIGLQFIGKPFDEKTLYRVAYQYETQYNLHDVYEKL GatB MHFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGETKRIGITRLHMEEDAGKSTHKGEYSLVDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEEELLNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTIPELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGVNEYLNKNQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNAKQIMEDNGLVQISDEATLLKFVNEALDNNEQSVEDYKNGKGKAMGFLVGQIMKASKGQANPQLVNQLLKQELDKRLEHHHHHH GatC MTKVTREEVEHIANLARLQISPEETEEMANTLESILDFAKQNDSADTEGVEPTYHVLDLQNVLREDKAIKGIPQELALKNAKETEDGQFKVPTIMNEEDA Open in a separate window caption a8 Macromolecule-production information (Nakamura et al. , 2006 , 2010 ) 2.2.

Techniques: Clone Assay, Expressing, Plasmid Preparation, Sequencing, Construct, Produced